Protein kinase Y linked (PRKY) (NM_002760) Human Mass Spec Standard
CAT#: PH310438
PRKY MS Standard C13 and N15-labeled recombinant protein (NP_002751)
View other "Protein kinase Y linked" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | PRKY MS Standard C13 and N15-labeled recombinant protein (NP_002751) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210438 |
Predicted MW | 31.7 kDa |
Protein Sequence |
>RC210438 protein sequence
Red=Cloning site Green=Tags(s) MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCDALVTMGTGTFGRVHLVKEKT AKHFFALKVMSIPDVIRRKQEQHVHNEKSVLKEVSHPFLIRLFWTWHEERFLYMLMEYVPGGELFSYLRN RGHFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILLDRDGHIKLTDFGFAKKLVDRTWTLCGTPEY LAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILAGKLYFPRHLDFHVKTGRMM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002751 |
RefSeq Size | 7216 |
RefSeq ORF | 831 |
Synonyms | OTTHUMP00000033227; protein kinase, Y-linked |
Locus ID | 5616 |
Cytogenetics | Yp11.2 |
Summary | This gene is similar to the protein kinase, X-linked gene in the pseudoautosomal region of the X chromosome. The gene is classified as a transcribed pseudogene because it has lost a coding exon that results in all transcripts being candidates for nonsense-mediated decay (NMD) and unlikely to express a protein. Abnormal recombination between this gene and a related gene on chromosome X is a frequent cause of XX males and XY females. [provided by RefSeq, Jul 2010] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400977 | PRKY HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400977 | Transient overexpression lysate of protein kinase, Y-linked (PRKY) |
CNY 3080.00 |
|
TP310438 | Recombinant protein of human protein kinase, Y-linked (PRKY), 20 µg |
CNY 2900.00 |
其它Protein kinase Y linked产品