Protein kinase Y linked (PRKY) (NM_002760) Human Recombinant Protein
CAT#: TP310438
Recombinant protein of human protein kinase, Y-linked (PRKY), 20 µg
View other "Protein kinase Y linked" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210438 protein sequence
Red=Cloning site Green=Tags(s) MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCDALVTMGTGTFGRVHLVKEKT AKHFFALKVMSIPDVIRRKQEQHVHNEKSVLKEVSHPFLIRLFWTWHEERFLYMLMEYVPGGELFSYLRN RGHFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILLDRDGHIKLTDFGFAKKLVDRTWTLCGTPEY LAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILAGKLYFPRHLDFHVKTGRMM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 31.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002751 |
| Locus ID | 5616 |
| UniProt ID | O43930 |
| Refseq Size | 7216 |
| Cytogenetics | Yp11.2 |
| Refseq ORF | 831 |
| Synonyms | OTTHUMP00000033227; protein kinase, Y-linked |
| Summary | This gene is similar to the protein kinase, X-linked gene in the pseudoautosomal region of the X chromosome. The gene is classified as a transcribed pseudogene because it has lost a coding exon that results in all transcripts being candidates for nonsense-mediated decay (NMD) and unlikely to express a protein. Abnormal recombination between this gene and a related gene on chromosome X is a frequent cause of XX males and XY females. [provided by RefSeq, Jul 2010] |
| Protein Families | Druggable Genome, Protein Kinase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400977 | PRKY HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400977 | Transient overexpression lysate of protein kinase, Y-linked (PRKY) |
CNY 3080.00 |
|
| PH310438 | PRKY MS Standard C13 and N15-labeled recombinant protein (NP_002751) |
CNY 19520.00 |
其它Protein kinase Y linked产品
