NIT2 (NM_020202) Human Mass Spec Standard
CAT#: PH310660
NIT2 MS Standard C13 and N15-labeled recombinant protein (NP_064587)
View other "NIT2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | NIT2 MS Standard C13 and N15-labeled recombinant protein (NP_064587) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210660 |
| Predicted MW | 30.6 kDa |
| Protein Sequence |
>RC210660 protein sequence
Red=Cloning site Green=Tags(s) MTSFRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVSLPECFNSPYGAKYFPEYAEKIPGESTQKLS EVAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVPGKITFQESKTLSPGDSFST FDTPYCRVGLGICYDMRFAELAQIYAQRGCQLLVYPGAFNLTTGPAHWELLQRSRAVDNQVYVATASPAR DDKASYVAWGHSTVVNPWGEVLAKAGTEEAIVYSDIDLKKLAEIRQQIPVFRQKRSDLYAVEMKKP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_064587 |
| RefSeq Size | 1271 |
| RefSeq ORF | 828 |
| Synonyms | HEL-S-8a |
| Locus ID | 56954 |
| Cytogenetics | 3q12.2 |
| Summary | Has a omega-amidase activity. The role of omega-amidase is to remove potentially toxic intermediates by converting alpha-ketoglutaramate and alpha-ketosuccinamate to biologically useful alpha-ketoglutarate and oxaloacetate, respectively. Overexpression decreases the colony-forming capacity of cultured cells by arresting cells in the G2 phase of the cell cycle.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402761 | NIT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402761 | Transient overexpression lysate of nitrilase family, member 2 (NIT2) |
CNY 3080.00 |
|
| TP310660 | Recombinant protein of human nitrilase family, member 2 (NIT2), 20 µg |
CNY 2900.00 |
