NDUF3 (NDUFAF3) (NM_199069) Human Mass Spec Standard
CAT#: PH310699
NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951032)
View other "NDUF3" proteins (16)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951032) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210699 |
Predicted MW | 13.8 kDa |
Protein Sequence |
>RC210699 protein sequence
Red=Cloning site Green=Tags(s) MYIDSYNSRGFMINGNRVLGPCALLPHSVVQWNVGSHQDITEDSFSLFWLLEPRIEIVVVGTGDRTERLQ SQVLQAMRQRGIAVEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_951032 |
RefSeq Size | 1387 |
RefSeq ORF | 381 |
Synonyms | 2P1; C3orf60; E3-3; MC1DN18 |
Locus ID | 25915 |
Cytogenetics | 3p21.31 |
Summary | This gene encodes a mitochondrial complex I assembly protein that interacts with complex I subunits. Mutations in this gene cause mitochondrial complex I deficiency, a fatal neonatal disorder of the oxidative phosphorylation system. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404729 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404730 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404732 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404733 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404729 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
LY404730 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
LY404732 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3080.00 |
|
LY404733 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 4 |
CNY 3080.00 |
|
PH302480 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951056) |
CNY 14250.00 |
|
PH317632 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951033) |
CNY 14250.00 |
|
PH317754 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951047) |
CNY 14250.00 |
|
TP302480 | Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 4, 20 µg |
CNY 2900.00 |
|
TP310699 | Recombinant protein of human chromosome 3 open reading frame 60 (C3orf60), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP317632 | Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP317754 | Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP318529 | Recombinant protein of human chromosome 3 open reading frame 60 (C3orf60), transcript variant 5, 20 µg |
CNY 2900.00 |