NDUF3 (NDUFAF3) (NM_199070) Human Recombinant Protein
CAT#: TP317632
Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 2, 20 µg
View other "NDUF3" proteins (16)
| Need it in bulk or customized? Get a free quote | Avi-tag Biotinylated Protein Get a free quote | 
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | >RC217632 protein sequence Red=Cloning site Green=Tags(s) MATALALRSLYRARPSLRCPPVELPWAPRRGHRLSPADDELYQRTRISLLQREAAQAMYIDSYNSRGFMI NGNRVLGPCALLPHSVVQWNVGSHQDITEDSFSLFWLLEPRIEIVVVGTGDRTERLQSQVLQAMRQRGIA VEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Predicted MW | 13.7 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_951033 | 
| Locus ID | 25915 | 
| UniProt ID | A4FU71 | 
| Refseq Size | 950 | 
| Cytogenetics | 3p21.31 | 
| Refseq ORF | 552 | 
| Synonyms | 2P1; C3orf60; E3-3; MC1DN18 | 
| Summary | This gene encodes a mitochondrial complex I assembly protein that interacts with complex I subunits. Mutations in this gene cause mitochondrial complex I deficiency, a fatal neonatal disorder of the oxidative phosphorylation system. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2009] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC404729 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LC404730 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LC404732 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LC404733 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY404729 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 1 | CNY 3080.00 | |
| LY404730 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 2 | CNY 3080.00 | |
| LY404732 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 3 | CNY 3080.00 | |
| LY404733 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 4 | CNY 3080.00 | |
| PH302480 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951056) | CNY 14250.00 | |
| PH310699 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951032) | CNY 19520.00 | |
| PH317632 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951033) | CNY 14250.00 | |
| PH317754 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951047) | CNY 14250.00 | |
| TP302480 | Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 4, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | |
| TP310699 | Recombinant protein of human chromosome 3 open reading frame 60 (C3orf60), transcript variant 1, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | |
| TP317754 | Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 3, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | |
| TP318529 | Recombinant protein of human chromosome 3 open reading frame 60 (C3orf60), transcript variant 5, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | 


 
                        
 
        