CMTM4 (NM_181521) Human Mass Spec Standard
CAT#: PH310793
CMTM4 MS Standard C13 and N15-labeled recombinant protein (NP_852662)
View other "CMTM4" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CMTM4 MS Standard C13 and N15-labeled recombinant protein (NP_852662) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210793 |
| Predicted MW | 22.7 kDa |
| Protein Sequence |
>RC210793 representing NM_181521
Red=Cloning site Green=Tags(s) MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFI CIETIMACSPCEGLYFFEFVSCSAFVVTGVLLIMFSLNLHMRIPQINWNLTDLVNTGLSAFLFFIASIVL AALNHRAGAEIAAVIFGFLETAAYAVNTFLAVQKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_852662 |
| RefSeq Size | 8133 |
| RefSeq ORF | 624 |
| Synonyms | CKLFSF4 |
| Locus ID | 146223 |
| Cytogenetics | 16q21-q22.1 |
| Summary | This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405676 | CMTM4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405803 | CMTM4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405676 | Transient overexpression lysate of CKLF-like MARVEL transmembrane domain containing 4 (CMTM4), transcript variant 2 |
CNY 3080.00 |
|
| LY405803 | Transient overexpression lysate of CKLF-like MARVEL transmembrane domain containing 4 (CMTM4), transcript variant 1 |
CNY 3080.00 |
|
| TP310793 | Recombinant protein of human CKLF-like MARVEL transmembrane domain containing 4 (CMTM4), transcript variant 2, 20 µg |
CNY 2900.00 |
