CMTM4 (NM_181521) Human Recombinant Protein
CAT#: TP310793
Recombinant protein of human CKLF-like MARVEL transmembrane domain containing 4 (CMTM4), transcript variant 2, 20 µg
View other "CMTM4" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210793 representing NM_181521
Red=Cloning site Green=Tags(s) MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFI CIETIMACSPCEGLYFFEFVSCSAFVVTGVLLIMFSLNLHMRIPQINWNLTDLVNTGLSAFLFFIASIVL AALNHRAGAEIAAVIFGFLETAAYAVNTFLAVQKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_852662 |
Locus ID | 146223 |
UniProt ID | Q8IZR5 |
Refseq Size | 8133 |
Cytogenetics | 16q21-q22.1 |
Refseq ORF | 624 |
Synonyms | CKLFSF4 |
Summary | This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405676 | CMTM4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405803 | CMTM4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405676 | Transient overexpression lysate of CKLF-like MARVEL transmembrane domain containing 4 (CMTM4), transcript variant 2 |
CNY 3080.00 |
|
LY405803 | Transient overexpression lysate of CKLF-like MARVEL transmembrane domain containing 4 (CMTM4), transcript variant 1 |
CNY 3080.00 |
|
PH310793 | CMTM4 MS Standard C13 and N15-labeled recombinant protein (NP_852662) |
CNY 19520.00 |