TCEAL2 (NM_080390) Human Mass Spec Standard
CAT#: PH311139
TCEAL2 MS Standard C13 and N15-labeled recombinant protein (NP_525129)
View other "TCEAL2" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | TCEAL2 MS Standard C13 and N15-labeled recombinant protein (NP_525129) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211139 |
Predicted MW | 25.8 kDa |
Protein Sequence |
>RC211139 protein sequence
Red=Cloning site Green=Tags(s) MEKLFNENEGMPSNQGKIDNEEQPPHEGKPEVACILEDKKLENEGNTENTGKRVEEPLKDKEKPESAGKA KGEGKSERKGKSEMQGGSKTEGKPERGGRAEGEGEPDSEREPESEGEPESETRAAGKRPAEDDIPRKAKR KTNKGLAQYLKQYKEAIHDMNFSNEDMIREFDNMARVEDKRRKSKQKLGAFLWMQRNLQDPFYPRGPREF RGGCRAPRRDTEDIPYV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_525129 |
RefSeq Size | 1123 |
RefSeq ORF | 681 |
Synonyms | my048; MY0876G05; WEX1 |
Locus ID | 140597 |
Cytogenetics | Xq22.1 |
Summary | This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located on the X chromosome. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409183 | TCEAL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409183 | Transient overexpression lysate of transcription elongation factor A (SII)-like 2 (TCEAL2) |
CNY 3080.00 |
|
TP311139 | Recombinant protein of human transcription elongation factor A (SII)-like 2 (TCEAL2), 20 µg |
CNY 2900.00 |
|
TP710155 | Recombinant protein of human transcription elongation factor A (SII)-like 2 (TCEAL2), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |