SLURP1 (NM_020427) Human Mass Spec Standard
CAT#: PH311275
SLURP1 MS Standard C13 and N15-labeled recombinant protein (NP_065160)
View other "SLURP1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
Specifications
Product Data | |
Description | SLURP1 MS Standard C13 and N15-labeled recombinant protein (NP_065160) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211275 |
Predicted MW | 11.2 kDa |
Protein Sequence |
>RC211275 protein sequence
Red=Cloning site Green=Tags(s) MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVT RSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_065160 |
RefSeq Size | 537 |
RefSeq ORF | 309 |
Synonyms | ANUP; ARS; ArsB; LY6-MT; LY6LS; MDM |
Locus ID | 57152 |
Cytogenetics | 8q24.3 |
Summary | The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412478 | SLURP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412478 | Transient overexpression lysate of secreted LY6/PLAUR domain containing 1 (SLURP1) |
CNY 3,080.00 |
|
TP311275 | Recombinant protein of human secreted LY6/PLAUR domain containing 1 (SLURP1), 20 µg |
CNY 2,900.00 |