SLURP1 (NM_020427) Human Recombinant Protein
CAT#: TP311275
Recombinant protein of human secreted LY6/PLAUR domain containing 1 (SLURP1), 20 µg
View other "SLURP1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211275 protein sequence
Red=Cloning site Green=Tags(s) MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVT RSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065160 |
Locus ID | 57152 |
UniProt ID | P55000 |
Refseq Size | 537 |
Cytogenetics | 8q24.3 |
Refseq ORF | 309 |
Synonyms | ANUP; ARS; ArsB; LY6-MT; LY6LS; MDM |
Summary | The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412478 | SLURP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412478 | Transient overexpression lysate of secreted LY6/PLAUR domain containing 1 (SLURP1) |
CNY 3080.00 |
|
PH311275 | SLURP1 MS Standard C13 and N15-labeled recombinant protein (NP_065160) |
CNY 19520.00 |