TIP30 (HTATIP2) (NM_001098522) Human Mass Spec Standard
CAT＃: PH312332
HTATIP2 MS Standard C13 and N15-labeled recombinant protein (NP_001091992)
View other "TIP30" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | HTATIP2 MS Standard C13 and N15-labeled recombinant protein (NP_001091992) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212332 |
| Predicted MW | 27.1 kDa |
| Protein Sequence |
>RC212332 protein sequence
Red=Cloning site Green=Tags(s) MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVV DFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSN FLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAM LNNVVRPRDKQMELLENKAIHDLGKAHGSLKP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001091992 |
| RefSeq Size | 1719 |
| RefSeq ORF | 726 |
| Synonyms | CC3; SDR44U1; TIP30 |
| Locus ID | 10553 |
| Cytogenetics | 11p15.1 |
| Summary | Oxidoreductase required for tumor suppression. NAPDH-bound form inhibits nuclear import by competing with nuclear import substrates for binding to a subset of nuclear transport receptors. May act as a redox sensor linked to transcription through regulation of nuclear import. Isoform 1 is a metastasis suppressor with proapoptotic as well as antiangiogenic properties. Isoform 2 has an antiapoptotic effect.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416670 | HTATIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420619 | HTATIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420620 | HTATIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420621 | HTATIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416670 | Transient overexpression lysate of HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 2 |
CNY 3080.00 |
|
| LY420619 | Transient overexpression lysate of HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 3 |
CNY 3080.00 |
|
| LY420620 | Transient overexpression lysate of HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 4 |
CNY 3080.00 |
|
| LY420621 | Transient overexpression lysate of HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 5 |
CNY 3080.00 |
|
| PH300276 | HTATIP2 MS Standard C13 and N15-labeled recombinant protein (NP_006401) |
CNY 19520.00 |
|
| TP300276 | Recombinant protein of human HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP312332 | Recombinant protein of human HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 4, 20 µg |
CNY 2900.00 |
