Amino terminal enhancer of split (AES) (NM_001130) Human Mass Spec Standard
CAT#: PH312475
AES MS Standard C13 and N15-labeled recombinant protein (NP_001121)
View other "Amino terminal enhancer of split" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | AES MS Standard C13 and N15-labeled recombinant protein (NP_001121) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212475 |
| Predicted MW | 21.8 kDa |
| Protein Sequence |
>RC212475 representing NM_001130
Red=Cloning site Green=Tags(s) MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYG LNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALAL PLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001121 |
| RefSeq Size | 1687 |
| RefSeq ORF | 591 |
| Synonyms | AES; AES-1; AES-2; ESP1; GRG; Grg-5; GRG5 |
| Locus ID | 166 |
| Cytogenetics | 19p13.3 |
| Summary | The protein encoded by this gene is similar in sequence to the amino terminus of Drosophila enhancer of split groucho, a protein involved in neurogenesis during embryonic development. The encoded protein, which belongs to the groucho/TLE family of proteins, can function as a homooligomer or as a heteroologimer with other family members to dominantly repress the expression of other family member genes. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404646 | AES HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420115 | AES HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404646 | Transient overexpression lysate of amino-terminal enhancer of split (AES), transcript variant 3 |
CNY 3080.00 |
|
| LY420115 | Transient overexpression lysate of amino-terminal enhancer of split (AES), transcript variant 2 |
CNY 3080.00 |
|
| PH313043 | AES MS Standard C13 and N15-labeled recombinant protein (NP_945321) |
CNY 14250.00 |
|
| TP312475 | Recombinant protein of human amino-terminal enhancer of split (AES), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP313043 | Purified recombinant protein of Homo sapiens amino-terminal enhancer of split (AES), transcript variant 3, 20 µg |
CNY 2900.00 |
其它Amino terminal enhancer of split产品
