Amino terminal enhancer of split (AES) (NM_001130) Human Recombinant Protein
CAT＃: TP312475
Recombinant protein of human amino-terminal enhancer of split (AES), transcript variant 2, 20 µg
View other "Amino terminal enhancer of split" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 2 publications. |
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212475 representing NM_001130
Red=Cloning site Green=Tags(s) MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYG LNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALAL PLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 21.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001121 |
| Locus ID | 166 |
| UniProt ID | Q08117 |
| Refseq Size | 1687 |
| Cytogenetics | 19p13.3 |
| Refseq ORF | 591 |
| Synonyms | AES; AES-1; AES-2; ESP1; GRG; Grg-5; GRG5 |
| Summary | The protein encoded by this gene is similar in sequence to the amino terminus of Drosophila enhancer of split groucho, a protein involved in neurogenesis during embryonic development. The encoded protein, which belongs to the groucho/TLE family of proteins, can function as a homooligomer or as a heteroologimer with other family members to dominantly repress the expression of other family member genes. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
A codon-shuffling method to prevent reversion during production of replication-defective herpesvirus stocks: Implications for herpesvirus vaccines
,null,
Scientific Reports
,PubMed ID 28287622
[TLE5]
|
|
Major Histocompatibility Complex Class II Transactivator CIITA Is a Viral Restriction Factor That Targets Human T-Cell Lymphotropic Virus Type 1 Tax-1 Function and Inhibits Viral Replication ▿
,null,
Journal of Virology
,PubMed ID 21813598
[TLE5]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404646 | AES HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420115 | AES HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404646 | Transient overexpression lysate of amino-terminal enhancer of split (AES), transcript variant 3 |
CNY 3080.00 |
|
| LY420115 | Transient overexpression lysate of amino-terminal enhancer of split (AES), transcript variant 2 |
CNY 3080.00 |
|
| PH312475 | AES MS Standard C13 and N15-labeled recombinant protein (NP_001121) |
CNY 19520.00 |
|
| PH313043 | AES MS Standard C13 and N15-labeled recombinant protein (NP_945321) |
CNY 14250.00 |
|
| TP313043 | Purified recombinant protein of Homo sapiens amino-terminal enhancer of split (AES), transcript variant 3, 20 µg |
CNY 2900.00 |
其它Amino terminal enhancer of split产品
