Lymphocyte Antigen 6 Complex (LY6K) (NM_017527) Human Mass Spec Standard
CAT#: PH312498
LY6K MS Standard C13 and N15-labeled recombinant protein (NP_059997)
View other "Lymphocyte Antigen 6 Complex" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
| Cited in 1 publication. |
Specifications
| Product Data | |
| Description | LY6K MS Standard C13 and N15-labeled recombinant protein (NP_059997) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212498 |
| Predicted MW | 25 kDa |
| Protein Sequence |
>RC212498 protein sequence
Red=Cloning site Green=Tags(s) MRLQRPRQAPAGGRRAPRGGRGSPYRPDPGRGARRLRRFQKGGEGAPRADPPWAPLGTMALLALLLVVAL PRVWTDANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVA KQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAGSMGESCGGLWLAIL LLLASIAAGLSLS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_059997 |
| RefSeq Size | 1747 |
| RefSeq ORF | 669 |
| Synonyms | CT97; HSJ001348; ly-6K; URLC10 |
| Locus ID | 54742 |
| Cytogenetics | 8q24.3 |
| Summary | Required for sperm migration into the oviduct and male fertility by controlling binding of sperm to zona pellucida (By similarity). May play a role in cell growth (PubMed:18089789).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
The European antibody network's practical guide to finding and validating suitable antibodies for research
,null,
mAbs
,PubMed ID 26418356
[LY6K]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413722 | LY6K HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413722 | Transient overexpression lysate of lymphocyte antigen 6 complex, locus K (LY6K), transcript variant 1 |
CNY 3080.00 |
|
| TP312498 | Recombinant protein of human lymphocyte antigen 6 complex, locus K (LY6K), 20 µg |
CNY 2900.00 |
其它Lymphocyte Antigen 6 Complex产品
