Lymphocyte Antigen 6 Complex (LY6K) (NM_017527) Human Recombinant Protein
CAT#: TP312498
Recombinant protein of human lymphocyte antigen 6 complex, locus K (LY6K), 20 µg
View other "Lymphocyte Antigen 6 Complex" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212498 protein sequence
Red=Cloning site Green=Tags(s) MRLQRPRQAPAGGRRAPRGGRGSPYRPDPGRGARRLRRFQKGGEGAPRADPPWAPLGTMALLALLLVVAL PRVWTDANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVA KQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAGSMGESCGGLWLAIL LLLASIAAGLSLS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 18.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_059997 |
| Locus ID | 54742 |
| UniProt ID | Q17RY6 |
| Refseq Size | 1747 |
| Cytogenetics | 8q24.3 |
| Refseq ORF | 669 |
| Synonyms | CT97; HSJ001348; ly-6K; URLC10 |
| Summary | Required for sperm migration into the oviduct and male fertility by controlling binding of sperm to zona pellucida (By similarity). May play a role in cell growth (PubMed:18089789).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413722 | LY6K HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413722 | Transient overexpression lysate of lymphocyte antigen 6 complex, locus K (LY6K), transcript variant 1 |
CNY 3080.00 |
|
| PH312498 | LY6K MS Standard C13 and N15-labeled recombinant protein (NP_059997) |
CNY 19520.00 |
其它Lymphocyte Antigen 6 Complex产品
