GMPPA (NM_205847) Human Mass Spec Standard
CAT#: PH312726
GMPPA MS Standard C13 and N15-labeled recombinant protein (NP_995319)
View other "GMPPA" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GMPPA MS Standard C13 and N15-labeled recombinant protein (NP_995319) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212726 |
| Predicted MW | 46.3 kDa |
| Protein Sequence |
>RC212726 protein sequence
Red=Cloning site Green=Tags(s) MLKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQPDEPLTQFLE AAQQEFNLPVRYLQEFAPLGTGGGLYHFRDQILAGSPEAFFVLNADVCSDFPLSAMLEAHRRQRHPFLLL GTTANRTQSLNYGCIVENPQTHEVLHYVEKPSTFISDIINCGIYLFSPEALKPLRDVFQRNQQDGQLEDS PGLWPGAGTIRLEQDVFSALAGQGQIYVHLTDGIWSQIKSAGSALYASRLYLSRYQDTHPERLAKHTPGG PWIRGNVYIHPTAKVAPSAVLGPNVSIGKGVTVGEGVRLRESIVLHGATLQEHTCVLHSIVGWGSTVGRW ARVEGTPSDPNPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRSFTNQIIL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_995319 |
| RefSeq Size | 1845 |
| RefSeq ORF | 1260 |
| Synonyms | AAMR |
| Locus ID | 29926 |
| Cytogenetics | 2q35 |
| Summary | This gene is thought to encode a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403717 | GMPPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC415641 | GMPPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429378 | GMPPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403717 | Transient overexpression lysate of GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 2 |
CNY 4840.00 |
|
| LY415641 | Transient overexpression lysate of GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 1 |
CNY 3080.00 |
|
| LY429378 | Transient overexpression lysate of GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 1 |
CNY 3080.00 |
|
| TP312726 | Recombinant protein of human GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 2, 20 µg |
CNY 2900.00 |
