GMPPA (NM_205847) Human Recombinant Protein
CAT#: TP312726
Recombinant protein of human GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 2, 20 µg
View other "GMPPA" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212726 protein sequence
Red=Cloning site Green=Tags(s) MLKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQPDEPLTQFLE AAQQEFNLPVRYLQEFAPLGTGGGLYHFRDQILAGSPEAFFVLNADVCSDFPLSAMLEAHRRQRHPFLLL GTTANRTQSLNYGCIVENPQTHEVLHYVEKPSTFISDIINCGIYLFSPEALKPLRDVFQRNQQDGQLEDS PGLWPGAGTIRLEQDVFSALAGQGQIYVHLTDGIWSQIKSAGSALYASRLYLSRYQDTHPERLAKHTPGG PWIRGNVYIHPTAKVAPSAVLGPNVSIGKGVTVGEGVRLRESIVLHGATLQEHTCVLHSIVGWGSTVGRW ARVEGTPSDPNPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRSFTNQIIL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 46.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_995319 |
| Locus ID | 29926 |
| UniProt ID | Q96IJ6 |
| Refseq Size | 1845 |
| Cytogenetics | 2q35 |
| Refseq ORF | 1260 |
| Synonyms | AAMR |
| Summary | This gene is thought to encode a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403717 | GMPPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC415641 | GMPPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429378 | GMPPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403717 | Transient overexpression lysate of GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 2 |
CNY 4840.00 |
|
| LY415641 | Transient overexpression lysate of GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 1 |
CNY 3080.00 |
|
| LY429378 | Transient overexpression lysate of GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 1 |
CNY 3080.00 |
|
| PH312726 | GMPPA MS Standard C13 and N15-labeled recombinant protein (NP_995319) |
CNY 19520.00 |
