SCML1 (NM_001037540) Human Mass Spec Standard
CAT#: PH312954
SCML1 MS Standard C13 and N15-labeled recombinant protein (NP_001032629)
View other "SCML1" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | SCML1 MS Standard C13 and N15-labeled recombinant protein (NP_001032629) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212954 |
Predicted MW | 37.3 kDa |
Protein Sequence |
>RC212954 representing NM_001037540
Red=Cloning site Green=Tags(s) MMSNSSSEIDVIKTRIPTYDEDDNTILYAYETKPEFVNKEPNIVSDASCNTEEQLKTVDDVLIHCQVIYD ALQNLDKKIDVIRRKVSKIQRFHARSLWTNHKRYGYKKHSYRLVKKLKLQKMKKNEVYETFSYPESYSPT LPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLC LGNPRADSIHNTYSTDHASAAPPSVTRSPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVD LFRSHEIDGKALLLLTSDVLLKHLGVKLGTAVKLCYYIDRLKQGKCFEN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001032629 |
RefSeq Size | 2923 |
RefSeq ORF | 987 |
Locus ID | 6322 |
Cytogenetics | Xp22.13 |
Summary | Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. May be involved in spermatogenesis during sexual maturation (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416443 | SCML1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421919 | SCML1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421922 | SCML1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416443 | Transient overexpression lysate of sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 2 |
CNY 3080.00 |
|
LY421919 | Transient overexpression lysate of sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 3 |
CNY 3080.00 |
|
LY421922 | Transient overexpression lysate of sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 1 |
CNY 3080.00 |
|
PH314112 | SCML1 MS Standard C13 and N15-labeled recombinant protein (NP_001032624) |
CNY 14250.00 |
|
TP312954 | Purified recombinant protein of Homo sapiens sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP314112 | Recombinant protein of human sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 3, 20 µg |
CNY 2900.00 |