SCML1 (NM_001037535) Human Recombinant Protein
CAT#: TP314112
Recombinant protein of human sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 3, 20 µg
View other "SCML1" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC214112 representing NM_001037535
Red=Cloning site Green=Tags(s) MMSNSSSEIDVQEPNIVSDASCNTEEQLKTVDDVLIHCQVIYDALQNLDKKIDVIRRKVSKIQRFHARSL WTNHKRYGYKKHSYRLVKKLKLQKMKKNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRA ELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHNTYSTDHASAAPPSVTR SPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVDLFRSHEIDGKALLLLTSDVLLKHLGVK LGTAVKLCYYIDRLKQGKCFEN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 23 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001032624 |
| Locus ID | 6322 |
| UniProt ID | Q9UN30 |
| Refseq Size | 2693 |
| Cytogenetics | Xp22.13 |
| Refseq ORF | 906 |
| Summary | Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. May be involved in spermatogenesis during sexual maturation (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416443 | SCML1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421919 | SCML1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421922 | SCML1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416443 | Transient overexpression lysate of sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 2 |
CNY 3080.00 |
|
| LY421919 | Transient overexpression lysate of sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 3 |
CNY 3080.00 |
|
| LY421922 | Transient overexpression lysate of sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 1 |
CNY 3080.00 |
|
| PH312954 | SCML1 MS Standard C13 and N15-labeled recombinant protein (NP_001032629) |
CNY 14250.00 |
|
| PH314112 | SCML1 MS Standard C13 and N15-labeled recombinant protein (NP_001032624) |
CNY 14250.00 |
|
| TP312954 | Purified recombinant protein of Homo sapiens sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 1, 20 µg |
CNY 2900.00 |

