DHLAG (CD74) (NM_001025159) Human Mass Spec Standard
CAT#: PH312964
CD74 MS Standard C13 and N15-labeled recombinant protein (NP_001020330)
View other "DHLAG" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | CD74 MS Standard C13 and N15-labeled recombinant protein (NP_001020330) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212964 |
Predicted MW | 33.3 kDa |
Protein Sequence |
>RC212964 representing NM_001025159
Red=Cloning site Green=Tags(s) MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYF LYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTED HVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVL TKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDP SSGLGVTKQDLGPVPM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001020330 |
RefSeq Size | 1519 |
RefSeq ORF | 888 |
Synonyms | DHLAG; HLADG; Ia-GAMMA; II; p33 |
Locus ID | 972 |
Cytogenetics | 5q33.1 |
Summary | The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Antigen processing and presentation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418040 | CD74 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422594 | CD74 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422595 | CD74 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429196 | CD74 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418040 | Transient overexpression lysate of CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 2 |
CNY 3080.00 |
|
LY422594 | Transient overexpression lysate of CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 3 |
CNY 3080.00 |
|
LY422595 | Transient overexpression lysate of CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 1 |
CNY 3080.00 |
|
LY429196 | Transient overexpression lysate of CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 2 |
CNY 3080.00 |
|
TP312964 | Recombinant protein of human CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 1, 20 µg |
CNY 2900.00 |