DHLAG (CD74) (NM_001025159) Human Recombinant Protein
CAT#: TP312964
Recombinant protein of human CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 1, 20 µg
View other "DHLAG" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212964 representing NM_001025159
Red=Cloning site Green=Tags(s) MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYF LYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTED HVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVL TKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDP SSGLGVTKQDLGPVPM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001020330 |
Locus ID | 972 |
UniProt ID | P04233 |
Refseq Size | 1519 |
Cytogenetics | 5q33.1 |
Refseq ORF | 888 |
Synonyms | DHLAG; HLADG; Ia-GAMMA; II; p33 |
Summary | The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Antigen processing and presentation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418040 | CD74 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422594 | CD74 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422595 | CD74 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429196 | CD74 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418040 | Transient overexpression lysate of CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 2 |
CNY 3080.00 |
|
LY422594 | Transient overexpression lysate of CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 3 |
CNY 3080.00 |
|
LY422595 | Transient overexpression lysate of CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 1 |
CNY 3080.00 |
|
LY429196 | Transient overexpression lysate of CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 2 |
CNY 3080.00 |
|
PH312964 | CD74 MS Standard C13 and N15-labeled recombinant protein (NP_001020330) |
CNY 19520.00 |