NY-ESO-1 (CTAG1B) (NM_001327) Human Mass Spec Standard
CAT#: PH313318
CTAG1B (NY-ESO-1) MS Standard C13 and N15-labeled recombinant protein (NP_001318)
View other "NY-ESO-1" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | CTAG1B (NY-ESO-1) MS Standard C13 and N15-labeled recombinant protein (NP_001318) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213318 |
Predicted MW | 17.8 kDa |
Protein Sequence |
>RC213318 representing NM_001327
Red=Cloning site Green=Tags(s) MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAAS GLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAA DHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001318 |
RefSeq Size | 806 |
RefSeq ORF | 540 |
Synonyms | CT6.1; CTAG; CTAG1; ESO1; LAGE-2; LAGE2B; NY-ESO-1 |
Locus ID | 1485 |
Cytogenetics | Xq28 |
Summary | The protein encoded by this gene is an antigen that is overexpressed in many cancers but that is also expressed in normal testis. This gene is found in a duplicated region of the X-chromosome and therefore has a neighboring gene of identical sequence. [provided by RefSeq, Jan 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400527 | CTAG1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400527 | Transient overexpression lysate of cancer/testis antigen 1B (CTAG1B/NY-ESO-1) |
CNY 3080.00 |
|
TP313318 | Recombinant protein of human cancer/testis antigen 1B (CTAG1B/NY-ESO-1), 20 µg |
CNY 2900.00 |
|
TP710205 | Purified recombinant protein of Homo sapiens cancer/testis antigen 1B (CTAG1B), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
其它NY-ESO-1产品