NY-ESO-1 (CTAG1B) (NM_001327) Human Recombinant Protein
CAT#: TP313318
Recombinant protein of human cancer/testis antigen 1B (CTAG1B/NY-ESO-1), 20 µg
View other "NY-ESO-1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Cited in 7 publications. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213318 representing NM_001327
Red=Cloning site Green=Tags(s) MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAAS GLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAA DHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.8 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | ELISA capture for autoantibodies (PMID: 27323861) ELISA capture for autoantibodies (PMID: 27793776) |
Reference Data | |
RefSeq | NP_001318 |
Locus ID | 1485 |
UniProt ID | P78358 |
Refseq Size | 806 |
Cytogenetics | Xq28 |
Refseq ORF | 540 |
Synonyms | CT6.1; CTAG; CTAG1; ESO1; LAGE-2; LAGE2B; NY-ESO-1 |
Summary | The protein encoded by this gene is an antigen that is overexpressed in many cancers but that is also expressed in normal testis. This gene is found in a duplicated region of the X-chromosome and therefore has a neighboring gene of identical sequence. [provided by RefSeq, Jan 2012] |
Protein Families | Druggable Genome |
Citations (7)
The use of this Proteins has been cited in the following citations: |
---|
Protein-Based Immunome Wide Association Studies (PIWAS) for the Discovery of Significant Disease-Associated Antigens
,null,
Frontiers in Immunology
,PubMed ID 33986742
[CTAG1B]
|
Autoantibody landscape in patients with advanced prostate cancer
,null,
Clinical cancer research : an official journal of the American Association for Cancer Research
,PubMed ID 32967941
[CTAG1B]
|
Autoantibody landscape of advanced prostate cancer
,Feng, FY;,
biorxiv
[CTAG1B]
|
B cells in esophago-gastric adenocarcinoma are highly differentiated, organize in tertiary lymphoid structures and produce tumor-specific antibodies
,Schlößer, HA;Thelen, M;Lechner, A;Wennhold, K;Garcia-Marquez, MA;Rothschild, SI;Staib, E;Zander, T;Beutner, D;Gathof, B;Gilles, R;Cukuroglu, E;Göke, J;Shimabukuro-Vornhagen, A;Drebber, U;Quaas, A;Bruns, CJ;Hölscher, AH;Von Bergwelt-Baildon, MS;,
Oncoimmunology
,PubMed ID 30546950
[CTAG1B]
|
Using Antigen-Specific B Cells to Combine Antibody and T Cell-Based Cancer Immunotherapy.
,null,
Cancer immunology research
,PubMed ID 28778961
[CTAG1B]
|
Case-Control Study: Smoking History Affects the Production of Tumor Antigen-Specific Antibodies NY-ESO-1 in Patients with Lung Cancer in Comparison with Cancer Disease-Free Group
,Myšíková, D;Adkins, I;Nad'a, H;Ondrej, P;Šimonek, J;Pozniak, J;Kolarík, J;Skallová-Fialová, A;Špíšek, R;Lischke, R;,
J Thorac Oncol
,PubMed ID 27793776
[CTAG1B]
|
Expression of tumor antigens on primary ovarian cancer cells compared to established ovarian cancer cell lines
,Kloudová, K;Hromádková, H;Partlová, S;Brtnický, T;Rob, L;Bartunková, J;Hensler, M;Halaška, MJ;Špíšek, R;Fialová, A;,
Oncotarget
,PubMed ID 27323861
[CTAG1B]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400527 | CTAG1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400527 | Transient overexpression lysate of cancer/testis antigen 1B (CTAG1B/NY-ESO-1) |
CNY 3080.00 |
|
PH313318 | CTAG1B (NY-ESO-1) MS Standard C13 and N15-labeled recombinant protein (NP_001318) |
CNY 19520.00 |
|
TP710205 | Purified recombinant protein of Homo sapiens cancer/testis antigen 1B (CTAG1B), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
其它NY-ESO-1产品