DNAJB13 (NM_153614) Human Mass Spec Standard
CAT#: PH314119
DNAJB13 MS Standard C13 and N15-labeled recombinant protein (NP_705842)
View other "DNAJB13" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | DNAJB13 MS Standard C13 and N15-labeled recombinant protein (NP_705842) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214119 |
| Predicted MW | 35.9 kDa |
| Protein Sequence |
>RC214119 representing NM_153614
Red=Cloning site Green=Tags(s) MGQDYYSVLGITRNSEDAQIKQAYRRLALKHHPLKSNEPSSAEIFRQIAEAYDVLSDPMKRGIYDKFGEE GLKGGIPLEFGSQTPWTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQV ERDLYLSLEDLFFGCTKKIKISRRVLNEDGYSSTIKDKILTIDVKPGWRQGTRITFEKEGDQGPNIIPAD IIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGEGMPL PEDPTKKGDLFIFFDIQFPTRLTPQKKQMLRQALLT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_705842 |
| RefSeq Size | 1875 |
| RefSeq ORF | 948 |
| Synonyms | CILD34; RSPH16A; TSARG5; TSARG6 |
| Locus ID | 374407 |
| Cytogenetics | 11q13.4 |
| Summary | This gene encodes a member of the heat shock protein 40 co-chaperone family which is produced in large amounts in the testis and is located on the radial spokes of the axoneme in human sperm flagella and other flagellar structures. The encoded protein associates with the sperm annulus, as part of the septin complex, through direct interaction with septin 4, during sperm terminal differentiation. Naturally occurring mutations in this gene are associated with primary ciliary dyskinesia and male infertility. [provided by RefSeq, Apr 2017] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406985 | DNAJB13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406985 | Transient overexpression lysate of DnaJ (Hsp40) related, subfamily B, member 13 (DNAJB13) |
CNY 3080.00 |
|
| TP314119 | Recombinant protein of human DnaJ (Hsp40) related, subfamily B, member 13 (DNAJB13), 20 µg |
CNY 2900.00 |
其它DNAJB13产品
