DNAJB13 (NM_153614) Human Recombinant Protein
CAT#: TP314119
Recombinant protein of human DnaJ (Hsp40) related, subfamily B, member 13 (DNAJB13), 20 µg
View other "DNAJB13" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC214119 representing NM_153614
Red=Cloning site Green=Tags(s) MGQDYYSVLGITRNSEDAQIKQAYRRLALKHHPLKSNEPSSAEIFRQIAEAYDVLSDPMKRGIYDKFGEE GLKGGIPLEFGSQTPWTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQV ERDLYLSLEDLFFGCTKKIKISRRVLNEDGYSSTIKDKILTIDVKPGWRQGTRITFEKEGDQGPNIIPAD IIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGEGMPL PEDPTKKGDLFIFFDIQFPTRLTPQKKQMLRQALLT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_705842 |
| Locus ID | 374407 |
| UniProt ID | P59910 |
| Refseq Size | 1875 |
| Cytogenetics | 11q13.4 |
| Refseq ORF | 948 |
| Synonyms | CILD34; RSPH16A; TSARG5; TSARG6 |
| Summary | This gene encodes a member of the heat shock protein 40 co-chaperone family which is produced in large amounts in the testis and is located on the radial spokes of the axoneme in human sperm flagella and other flagellar structures. The encoded protein associates with the sperm annulus, as part of the septin complex, through direct interaction with septin 4, during sperm terminal differentiation. Naturally occurring mutations in this gene are associated with primary ciliary dyskinesia and male infertility. [provided by RefSeq, Apr 2017] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406985 | DNAJB13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406985 | Transient overexpression lysate of DnaJ (Hsp40) related, subfamily B, member 13 (DNAJB13) |
CNY 3080.00 |
|
| PH314119 | DNAJB13 MS Standard C13 and N15-labeled recombinant protein (NP_705842) |
CNY 19520.00 |
其它DNAJB13产品
