p18 INK4c (CDKN2C) (NM_078626) Human Mass Spec Standard
CAT#: PH314412
CDKN2C MS Standard C13 and N15-labeled recombinant protein (NP_523240)
View other "p18 INK4c" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | CDKN2C MS Standard C13 and N15-labeled recombinant protein (NP_523240) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214412 |
| Predicted MW | 18.1 kDa |
| Protein Sequence |
>RC214412 protein sequence
Red=Cloning site Green=Tags(s) MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTG FAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTA CDLARLYGRNEVVSLMQANGAGGATNLQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_523240 |
| RefSeq Size | 1273 |
| RefSeq ORF | 504 |
| Synonyms | INK4C; p18; p18-INK4C |
| Locus ID | 1031 |
| Cytogenetics | 1p32.3 |
| Summary | The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Cell cycle |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409196 | CDKN2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420041 | CDKN2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429933 | CDKN2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409196 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) (CDKN2C), transcript variant 2 |
CNY 3080.00 |
|
| LY420041 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) (CDKN2C), transcript variant 1 |
CNY 3080.00 |
|
| LY429933 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) (CDKN2C), transcript variant 2 |
CNY 3080.00 |
|
| PH313083 | CDKN2C MS Standard C13 and N15-labeled recombinant protein (NP_001253) |
CNY 19520.00 |
|
| TP313083 | Recombinant protein of human cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) (CDKN2C), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP314412 | Recombinant protein of human cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) (CDKN2C), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP720216 | Recombinant protein of human cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) (CDKN2C), transcript variant 1 |
CNY 1800.00 |
其它p18 INK4c产品
