p18 INK4c (CDKN2C) (NM_078626) Human Recombinant Protein
CAT#: TP314412
Recombinant protein of human cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) (CDKN2C), transcript variant 2, 20 µg
View other "p18 INK4c" proteins (10)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214412 protein sequence
Red=Cloning site Green=Tags(s) MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTG FAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTA CDLARLYGRNEVVSLMQANGAGGATNLQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_523240 |
Locus ID | 1031 |
UniProt ID | P42773 |
Refseq Size | 1273 |
Cytogenetics | 1p32.3 |
Refseq ORF | 504 |
Synonyms | INK4C; p18; p18-INK4C |
Summary | The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409196 | CDKN2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420041 | CDKN2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429933 | CDKN2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409196 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) (CDKN2C), transcript variant 2 |
CNY 3080.00 |
|
LY420041 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) (CDKN2C), transcript variant 1 |
CNY 3080.00 |
|
LY429933 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) (CDKN2C), transcript variant 2 |
CNY 3080.00 |
|
PH313083 | CDKN2C MS Standard C13 and N15-labeled recombinant protein (NP_001253) |
CNY 19520.00 |
|
PH314412 | CDKN2C MS Standard C13 and N15-labeled recombinant protein (NP_523240) |
CNY 19520.00 |
|
TP313083 | Recombinant protein of human cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) (CDKN2C), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP720216 | Recombinant protein of human cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) (CDKN2C), transcript variant 1 |
CNY 1800.00 |
其它p18 INK4c产品