PGPEP1 (NM_017712) Human Mass Spec Standard
CAT#: PH314837
PGPEP1 MS Standard C13 and N15-labeled recombinant protein (NP_060182)
View other "PGPEP1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PGPEP1 MS Standard C13 and N15-labeled recombinant protein (NP_060182) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214837 |
Predicted MW | 23 kDa |
Protein Sequence |
>RC214837 representing NM_017712
Red=Cloning site Green=Tags(s) MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHSPQLV VHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTI SQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQLGRALRAIIEEMLDLLEQSEGKINYCHKH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060182 |
RefSeq Size | 2239 |
RefSeq ORF | 627 |
Synonyms | PAP-I; Pcp; PGI; PGP; PGP-I; PGPI |
Locus ID | 54858 |
Cytogenetics | 19p13.11 |
Summary | The gene encodes a cysteine protease and member of the peptidase C15 family of proteins. The encoded protein cleaves amino terminal pyroglutamate residues from protein substrates including thyrotropin-releasing hormone and other neuropeptides. Expression of this gene may be downregulated in colorectal cancer, while activity of the encoded protein may be negatively correlated with cancer progression in colorectal cancer patients. Activity of the encoded protease may also be altered in other disease states including in liver cirrhosis, which is associated with reduced protease activity, and in necrozoospermia, which is associated with elevated protease activity. [provided by RefSeq, Jul 2016] |
Protein Families | Druggable Genome, Protease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413619 | PGPEP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413619 | Transient overexpression lysate of pyroglutamyl-peptidase I (PGPEP1) |
CNY 3080.00 |
|
TP314837 | Recombinant protein of human pyroglutamyl-peptidase I (PGPEP1), 20 µg |
CNY 2900.00 |