PGPEP1 (NM_017712) Human Recombinant Protein
CAT#: TP314837
Recombinant protein of human pyroglutamyl-peptidase I (PGPEP1), 20 µg
View other "PGPEP1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC214837 representing NM_017712
Red=Cloning site Green=Tags(s) MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHSPQLV VHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTI SQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQLGRALRAIIEEMLDLLEQSEGKINYCHKH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 23 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_060182 |
| Locus ID | 54858 |
| UniProt ID | Q9NXJ5 |
| Refseq Size | 2239 |
| Cytogenetics | 19p13.11 |
| Refseq ORF | 627 |
| Synonyms | PAP-I; Pcp; PGI; PGP; PGP-I; PGPI |
| Summary | The gene encodes a cysteine protease and member of the peptidase C15 family of proteins. The encoded protein cleaves amino terminal pyroglutamate residues from protein substrates including thyrotropin-releasing hormone and other neuropeptides. Expression of this gene may be downregulated in colorectal cancer, while activity of the encoded protein may be negatively correlated with cancer progression in colorectal cancer patients. Activity of the encoded protease may also be altered in other disease states including in liver cirrhosis, which is associated with reduced protease activity, and in necrozoospermia, which is associated with elevated protease activity. [provided by RefSeq, Jul 2016] |
| Protein Families | Druggable Genome, Protease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413619 | PGPEP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413619 | Transient overexpression lysate of pyroglutamyl-peptidase I (PGPEP1) |
CNY 3080.00 |
|
| PH314837 | PGPEP1 MS Standard C13 and N15-labeled recombinant protein (NP_060182) |
CNY 19520.00 |
