ELMO1 (NM_014800) Human Mass Spec Standard
CAT#: PH315541
ELMO1 MS Standard C13 and N15-labeled recombinant protein (NP_055615)
View other "ELMO1" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ELMO1 MS Standard C13 and N15-labeled recombinant protein (NP_055615) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215541 |
| Predicted MW | 83.6 kDa |
| Protein Sequence |
>RC215541 representing NM_014800
Red=Cloning site Green=Tags(s) MPPPADIVKVAIEWPGAYPKLMEIDQKKPLSAIIKEVCDGWSLANHEYFALQHADSSNFYITEKNRNEIK NGTILRLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEFINLDGISLLTQMVESGTERY QKLQKIMKPCFGDMLSFTLTAFVELMDHGIVSWDTFSVAFIKKIASFVNKSAIDISILQRSLAILESMVL NSHDLYQKVAQEITIGQLIPHLQGSDQEIQTYTIAVINALFLKAPDERRQEMANILAQKQLRSIILTHVI RAQRAINNEMAHQLYVLQVLTFNLLEDRMMTKMDPQDQAQRDIIFELRRIAFDAESEPNNSSGSMEKRKS MYTRDYKKLGFINHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIEL TKMLCEILKVGELPSETCNDFHPMFFTHDRSFEEFFCICIQLLNKTWKEMRATSEDFNKVMQVVKEQVMR ALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKIQPEILELIKQQRLNRLVEGT CFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMKEKGA LKQNKEVLELAFSILYDSNCQLNFIAPDKHEYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLD LENIQIPDAPPPIPKEPSNYDFVYDCN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055615 |
| RefSeq Size | 3727 |
| RefSeq ORF | 2181 |
| Synonyms | CED-12; CED12; ELMO-1 |
| Locus ID | 9844 |
| Cytogenetics | 7p14.2-p14.1 |
| Summary | This gene encodes a member of the engulfment and cell motility protein family. These proteins interact with dedicator of cytokinesis proteins to promote phagocytosis and cell migration. Increased expression of this gene and dedicator of cytokinesis 1 may promote glioma cell invasion, and single nucleotide polymorphisms in this gene may be associated with diabetic nephropathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
| Protein Pathways | Chemokine signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403326 | ELMO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415009 | ELMO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422048 | ELMO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403326 | Transient overexpression lysate of engulfment and cell motility 1 (ELMO1), transcript variant 2 |
CNY 3080.00 |
|
| LY415009 | Transient overexpression lysate of engulfment and cell motility 1 (ELMO1), transcript variant 1 |
CNY 4840.00 |
|
| LY422048 | Transient overexpression lysate of engulfment and cell motility 1 (ELMO1), transcript variant 3 |
CNY 3080.00 |
|
| PH315722 | ELMO1 MS Standard C13 and N15-labeled recombinant protein (NP_001034548) |
CNY 19520.00 |
|
| TP315541 | Recombinant protein of human engulfment and cell motility 1 (ELMO1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP315722 | Recombinant protein of human engulfment and cell motility 1 (ELMO1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP760401 | Purified recombinant protein of Human engulfment and cell motility 1 (ELMO1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
