ELMO1 (NM_001039459) Human Recombinant Protein
CAT#: TP315722
Recombinant protein of human engulfment and cell motility 1 (ELMO1), transcript variant 3, 20 µg
View other "ELMO1" proteins (10)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC215722 protein sequence
Red=Cloning site Green=Tags(s) MPPPADIVKVAIEWPGAYPKLMEIDQKKPLSAIIKEVCDGWSLANHEYFALQHADSSNFYITEKNRNEIK NGTILRLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEFINLDGISLLTQMVESGTERY QKLQKIMKPCFGDMLSFTLTAFVELMDHGIVSWDTFSVAFIKKIASFVNKSAIDISILQRSLAILESMVL NSHDLYQKVAQEITIGQLIPHLQGSDQEIQTYTIAVINALFLKAPDERRQEMANILAQKQLRSIILTHVI RAQRAINNEMAHQLYVLQVLTFNLLEDRMMTKMDPQDQAQRDIIFELRRIAFDAESEPNNSSGSMEKRKS MYTRDYKKLGFINHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIEL TKMLCEILKVGELPSETCNDFHPMFFTHDRSFEEFFCICIQLLNKTWKEMRATSEDFNKVMQVVKEQVMR ALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKIQPEILELIKQQRLNRLVEGT CFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMKEKGA LKQNKEVLELAFSILYDSNCQLNFIAPDKHEYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLD LENIQIPDAPPPIPKEPSNYDFVYDCN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 28.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001034548 |
| Locus ID | 9844 |
| UniProt ID | Q92556 |
| Refseq Size | 3590 |
| Cytogenetics | 7p14.2-p14.1 |
| Refseq ORF | 2181 |
| Synonyms | CED-12; CED12; ELMO-1 |
| Summary | This gene encodes a member of the engulfment and cell motility protein family. These proteins interact with dedicator of cytokinesis proteins to promote phagocytosis and cell migration. Increased expression of this gene and dedicator of cytokinesis 1 may promote glioma cell invasion, and single nucleotide polymorphisms in this gene may be associated with diabetic nephropathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
| Protein Pathways | Chemokine signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403326 | ELMO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415009 | ELMO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422048 | ELMO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403326 | Transient overexpression lysate of engulfment and cell motility 1 (ELMO1), transcript variant 2 |
CNY 3080.00 |
|
| LY415009 | Transient overexpression lysate of engulfment and cell motility 1 (ELMO1), transcript variant 1 |
CNY 4840.00 |
|
| LY422048 | Transient overexpression lysate of engulfment and cell motility 1 (ELMO1), transcript variant 3 |
CNY 3080.00 |
|
| PH315541 | ELMO1 MS Standard C13 and N15-labeled recombinant protein (NP_055615) |
CNY 19520.00 |
|
| PH315722 | ELMO1 MS Standard C13 and N15-labeled recombinant protein (NP_001034548) |
CNY 19520.00 |
|
| TP315541 | Recombinant protein of human engulfment and cell motility 1 (ELMO1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP760401 | Purified recombinant protein of Human engulfment and cell motility 1 (ELMO1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
