FAM36A (COX20) (NM_198076) Human Mass Spec Standard
CAT#: PH317381
FAM36A MS Standard C13 and N15-labeled recombinant protein (NP_932342)
View other "FAM36A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | FAM36A MS Standard C13 and N15-labeled recombinant protein (NP_932342) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217381 |
Predicted MW | 13.3 kDa |
Protein Sequence |
>RC217381 protein sequence
Red=Cloning site Green=Tags(s) MAAPPEPGEPEERKSLKLLGFLDVENTPCARHSILYGSLGSVVAGFGHFLFTSRIRRSCDVGVGGFILVT LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_932342 |
RefSeq Size | 2632 |
RefSeq ORF | 354 |
Synonyms | FAM36A; MC4DN11 |
Locus ID | 116228 |
Cytogenetics | 1q44 |
Summary | This gene encodes a protein that plays a role in the assembly of cytochrome C oxidase, an important component of the respiratory pathway. It contains two transmembrane helices and localizes to the mitochondrial membrane. Mutations in this gene can cause mitochondrial complex IV deficiency, which results in ataxia and muscle hypotonia. There are multiple pseudogenes for this gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405090 | COX20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405090 | Transient overexpression lysate of family with sequence similarity 36, member A (FAM36A) |
CNY 3080.00 |
|
TP317381 | Recombinant protein of human family with sequence similarity 36, member A (FAM36A), 20 µg |
CNY 2900.00 |