RbAp46 (RBBP7) (NM_002893) Human Mass Spec Standard
CAT#: PH317969
RBBP7 MS Standard C13 and N15-labeled recombinant protein (NP_002884)
View other "RbAp46" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | RBBP7 MS Standard C13 and N15-labeled recombinant protein (NP_002884) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217969 |
Predicted MW | 47.8 kDa |
Protein Sequence |
>RC217969 protein sequence
Red=Cloning site Green=Tags(s) MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTH TSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIA TKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGP KEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSF NPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIG EEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSEL EGQGS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002884 |
RefSeq Size | 2021 |
RefSeq ORF | 1275 |
Synonyms | RbAp46 |
Locus ID | 5931 |
Cytogenetics | Xp22.2 |
Summary | This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation. The encoded protein is found in many histone deacetylase complexes, including mSin3 co-repressor complex. It is also present in protein complexes involved in chromatin assembly. This protein can interact with BRCA1 tumor-suppressor gene and may have a role in the regulation of cell proliferation and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419038 | RBBP7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC434255 | RBBP7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419038 | Transient overexpression lysate of retinoblastoma binding protein 7 (RBBP7) |
CNY 4840.00 |
|
LY434255 | Transient overexpression lysate of retinoblastoma binding protein 7 (RBBP7), transcript variant 1 |
CNY 3080.00 |
|
TP317969 | Recombinant protein of human retinoblastoma binding protein 7 (RBBP7), 20 µg |
CNY 2900.00 |