RbAp46 (RBBP7) (NM_002893) Human Recombinant Protein
CAT#: TP317969
Recombinant protein of human retinoblastoma binding protein 7 (RBBP7), 20 µg
View other "RbAp46" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217969 protein sequence
Red=Cloning site Green=Tags(s) MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTH TSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIA TKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGP KEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSF NPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIG EEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSEL EGQGS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 47.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002884 |
| Locus ID | 5931 |
| UniProt ID | Q16576 |
| Refseq Size | 2021 |
| Cytogenetics | Xp22.2 |
| Refseq ORF | 1275 |
| Synonyms | RbAp46 |
| Summary | This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation. The encoded protein is found in many histone deacetylase complexes, including mSin3 co-repressor complex. It is also present in protein complexes involved in chromatin assembly. This protein can interact with BRCA1 tumor-suppressor gene and may have a role in the regulation of cell proliferation and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419038 | RBBP7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC434255 | RBBP7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419038 | Transient overexpression lysate of retinoblastoma binding protein 7 (RBBP7) |
CNY 4840.00 |
|
| LY434255 | Transient overexpression lysate of retinoblastoma binding protein 7 (RBBP7), transcript variant 1 |
CNY 3080.00 |
|
| PH317969 | RBBP7 MS Standard C13 and N15-labeled recombinant protein (NP_002884) |
CNY 19520.00 |
