VAV3 (NM_001079874) Human Mass Spec Standard
CAT#: PH318352
VAV3 MS Standard C13 and N15-labeled recombinant protein (NP_001073343)
View other "VAV3" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | VAV3 MS Standard C13 and N15-labeled recombinant protein (NP_001073343) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218352 |
Predicted MW | 32.4 kDa |
Protein Sequence |
>RC218352 representing NM_001079874
Red=Cloning site Green=Tags(s) MPIFTFLSEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVIRNYSGTPPPALHEGPPLQLQAGDTVELLKG DAHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRT KESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPE HSAGQRGNRAGNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPS TYVEEDE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001073343 |
RefSeq Size | 3115 |
RefSeq ORF | 861 |
Locus ID | 10451 |
Cytogenetics | 1p13.3 |
Summary | This gene is a member of the VAV gene family. The VAV proteins are guanine nucleotide exchange factors (GEFs) for Rho family GTPases that activate pathways leading to actin cytoskeletal rearrangements and transcriptional alterations. This gene product acts as a GEF preferentially for RhoG, RhoA, and to a lesser extent, RAC1, and it associates maximally with the nucleotide-free states of these GTPases. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | B cell receptor signaling pathway, Chemokine signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Leukocyte transendothelial migration, Natural killer cell mediated cytotoxicity, Regulation of actin cytoskeleton, T cell receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416860 | VAV3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC421571 | VAV3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416860 | Transient overexpression lysate of vav 3 guanine nucleotide exchange factor (VAV3), transcript variant 1 |
CNY 4840.00 |
|
LY421571 | Transient overexpression lysate of vav 3 guanine nucleotide exchange factor (VAV3), transcript variant 2 |
CNY 3080.00 |
|
PH320550 | VAV3 MS Standard C13 and N15-labeled recombinant protein (NP_006104) |
CNY 19520.00 |
|
TP318352 | Recombinant protein of human vav 3 guanine nucleotide exchange factor (VAV3), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP320550 | Recombinant protein of human vav 3 guanine nucleotide exchange factor (VAV3), transcript variant 1, 20 µg |
CNY 2900.00 |