VAV3 (NM_001079874) Human Recombinant Protein
CAT#: TP318352
Recombinant protein of human vav 3 guanine nucleotide exchange factor (VAV3), transcript variant 2, 20 µg
View other "VAV3" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218352 representing NM_001079874
Red=Cloning site Green=Tags(s) MPIFTFLSEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVIRNYSGTPPPALHEGPPLQLQAGDTVELLKG DAHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRT KESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPE HSAGQRGNRAGNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPS TYVEEDE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 32.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001073343 |
| Locus ID | 10451 |
| UniProt ID | Q9UKW4 |
| Refseq Size | 3115 |
| Cytogenetics | 1p13.3 |
| Refseq ORF | 861 |
| Summary | This gene is a member of the VAV gene family. The VAV proteins are guanine nucleotide exchange factors (GEFs) for Rho family GTPases that activate pathways leading to actin cytoskeletal rearrangements and transcriptional alterations. This gene product acts as a GEF preferentially for RhoG, RhoA, and to a lesser extent, RAC1, and it associates maximally with the nucleotide-free states of these GTPases. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | B cell receptor signaling pathway, Chemokine signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Leukocyte transendothelial migration, Natural killer cell mediated cytotoxicity, Regulation of actin cytoskeleton, T cell receptor signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416860 | VAV3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC421571 | VAV3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416860 | Transient overexpression lysate of vav 3 guanine nucleotide exchange factor (VAV3), transcript variant 1 |
CNY 4840.00 |
|
| LY421571 | Transient overexpression lysate of vav 3 guanine nucleotide exchange factor (VAV3), transcript variant 2 |
CNY 3080.00 |
|
| PH318352 | VAV3 MS Standard C13 and N15-labeled recombinant protein (NP_001073343) |
CNY 19520.00 |
|
| PH320550 | VAV3 MS Standard C13 and N15-labeled recombinant protein (NP_006104) |
CNY 19520.00 |
|
| TP320550 | Recombinant protein of human vav 3 guanine nucleotide exchange factor (VAV3), transcript variant 1, 20 µg |
CNY 2900.00 |
