AMPK alpha 1 (PRKAA1) (NM_006251) Human Mass Spec Standard
CAT#: PH318572
PRKAA1 MS Standard C13 and N15-labeled recombinant protein (NP_006242)
View other "AMPK alpha 1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | PRKAA1 MS Standard C13 and N15-labeled recombinant protein (NP_006242) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218572 |
| Predicted MW | 63.8 kDa |
| Protein Sequence |
>RC218572 representing NM_006251
Red=Cloning site Green=Tags(s) MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVG KIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDY CHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWS SGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFK QDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKD FYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTAT PQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006242 |
| RefSeq Size | 5085 |
| RefSeq ORF | 1677 |
| Synonyms | AMPK; AMPKa1; AMPK alpha 1 |
| Locus ID | 5562 |
| Cytogenetics | 5p13.1 |
| Summary | The protein encoded by this gene belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Adipocytokine signaling pathway, Hypertrophic cardiomyopathy (HCM), Insulin signaling pathway, mTOR signaling pathway, Regulation of autophagy |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404162 | PRKAA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC416771 | PRKAA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY404162 | Transient overexpression lysate of protein kinase, AMP-activated, alpha 1 catalytic subunit (PRKAA1), transcript variant 2 |
CNY 4840.00 |
|
| LY416771 | Transient overexpression lysate of protein kinase, AMP-activated, alpha 1 catalytic subunit (PRKAA1), transcript variant 1 |
CNY 4840.00 |
|
| TP318572 | Recombinant protein of human protein kinase, AMP-activated, alpha 1 catalytic subunit (PRKAA1), transcript variant 1, 20 µg |
CNY 2900.00 |
其它AMPK alpha 1产品
