MBNL2 (NM_207304) Human Mass Spec Standard
CAT#: PH319730
MBNL2 MS Standard C13 and N15-labeled recombinant protein (NP_997187)
View other "MBNL2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MBNL2 MS Standard C13 and N15-labeled recombinant protein (NP_997187) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219730 |
| Predicted MW | 39.4 kDa |
| Protein Sequence |
>RC219730 protein sequence
Red=Cloning site Green=Tags(s) MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSRENCKYLH PPTHLKTQLEINGRNNLIQQKTAAAMLAQQMQFMFPGTPLHPVPTFPVGPAIGTNTAISFAPYLAPVTPG VGLVPTEILPTTPVIVPGSPPVTVPGSTATQKLLRTDKLEVCREFQRGNCARGETDCRFAHPADSTMIDT SDNTVTVCMDYIKGRCMREKCKYFHPPAHLQAKIKAAQHQANQAAVAAQAAAAAATVMAFPPGALHPLPK RQALEKSNGTSAVFNPSVLHYQQALTSAQLQQHAAFIPTDNSEIISRNGMECQESALRITKHCYCTYYPV SSSIELPQTAC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_997187 |
| RefSeq Size | 4624 |
| RefSeq ORF | 1083 |
| Synonyms | MBLL; MBLL39; PRO2032 |
| Locus ID | 10150 |
| Cytogenetics | 13q32.1 |
| Summary | This gene is a member of the muscleblind protein family which was initially described in Drosophila melanogaster. This gene encodes a C3H-type zinc finger protein that modulates alternative splicing of pre-mRNAs. Muscleblind proteins bind specifically to expanded dsCUG RNA but not to normal size CUG repeats and may thereby play a role in the pathophysiology of myotonic dystrophy. Several alternatively spliced transcript variants have been described but the full-length natures of only some have been determined. [provided by RefSeq, Mar 2012] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403412 | MBNL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404083 | MBNL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403412 | Transient overexpression lysate of muscleblind-like 2 (Drosophila) (MBNL2), transcript variant 1 |
CNY 3080.00 |
|
| LY404083 | Transient overexpression lysate of muscleblind-like 2 (Drosophila) (MBNL2), transcript variant 3 |
CNY 3080.00 |
|
| TP319730 | Recombinant protein of human muscleblind-like 2 (Drosophila) (MBNL2), transcript variant 3, 20 µg |
CNY 2900.00 |
