FAM107A (NM_007177) Human Mass Spec Standard
CAT＃: PH319825
FAM107A MS Standard C13 and N15-labeled recombinant protein (NP_009108)
View other "FAM107A" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | FAM107A MS Standard C13 and N15-labeled recombinant protein (NP_009108) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219825 |
| Predicted MW | 17.5 kDa |
| Protein Sequence |
>RC219825 protein sequence
Red=Cloning site Green=Tags(s) MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRV LEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSE EREL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_009108 |
| RefSeq Size | 3488 |
| RefSeq ORF | 432 |
| Synonyms | DRR1; TU3A |
| Locus ID | 11170 |
| Cytogenetics | 3p14.3-p14.2 |
| Summary | Stress-inducible actin-binding protein that plays a role in synaptic and cognitive functions by modulating actin filamentous (F-actin) dynamics. Mediates polymerization of globular actin to F-actin. Also binds to, stabilizes and bundles F-actin. Involved in synaptic function by regulating neurite outgrowth in an actin-dependent manner and for the acquisition of hippocampus-dependent cognitive function, such as learning and long-term memory (By similarity). Plays a role in the actin and microtubule cytoskeleton organization; negatively regulates focal adhesion (FA) assembly promoting malignant glial cell migration in an actin-, microtubule- and MAP1A-dependent manner (PubMed:20543869). Also involved in neuroblastoma G1/S phase cell cycle progression and cell proliferation inhibition by stimulating ubiquitination of NF-kappa-B subunit RELA and NF-kappa-B degradation in a COMMD1- and actin-dependent manner (PubMed:10564580, PubMed:28604741). May play a role in tumor development (PubMed:10564580).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416150 | FAM107A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421362 | FAM107A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416150 | Transient overexpression lysate of family with sequence similarity 107, member A (FAM107A), transcript variant 1 |
CNY 3080.00 |
|
| LY421362 | Transient overexpression lysate of family with sequence similarity 107, member A (FAM107A), transcript variant 2 |
CNY 3080.00 |
|
| PH303787 | FAM107A MS Standard C13 and N15-labeled recombinant protein (NP_001070246) |
CNY 19520.00 |
|
| TP303787 | Recombinant protein of human family with sequence similarity 107, member A (FAM107A), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP319825 | Recombinant protein of human family with sequence similarity 107, member A (FAM107A), transcript variant 1, 20 µg |
CNY 2900.00 |
其它FAM107A产品
