FAM107A (NM_001076778) Human Recombinant Protein
CAT#: TP303787
Recombinant protein of human family with sequence similarity 107, member A (FAM107A), transcript variant 2, 20 µg
View other "FAM107A" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203787 protein sequence
Red=Cloning site Green=Tags(s) MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRV LEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSE EREL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001070246 |
Locus ID | 11170 |
UniProt ID | O95990 |
Refseq Size | 3390 |
Cytogenetics | 3p14.3-p14.2 |
Refseq ORF | 432 |
Synonyms | DRR1; TU3A |
Summary | Stress-inducible actin-binding protein that plays a role in synaptic and cognitive functions by modulating actin filamentous (F-actin) dynamics. Mediates polymerization of globular actin to F-actin. Also binds to, stabilizes and bundles F-actin. Involved in synaptic function by regulating neurite outgrowth in an actin-dependent manner and for the acquisition of hippocampus-dependent cognitive function, such as learning and long-term memory (By similarity). Plays a role in the actin and microtubule cytoskeleton organization; negatively regulates focal adhesion (FA) assembly promoting malignant glial cell migration in an actin-, microtubule- and MAP1A-dependent manner (PubMed:20543869). Also involved in neuroblastoma G1/S phase cell cycle progression and cell proliferation inhibition by stimulating ubiquitination of NF-kappa-B subunit RELA and NF-kappa-B degradation in a COMMD1- and actin-dependent manner (PubMed:10564580, PubMed:28604741). May play a role in tumor development (PubMed:10564580).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416150 | FAM107A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421362 | FAM107A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416150 | Transient overexpression lysate of family with sequence similarity 107, member A (FAM107A), transcript variant 1 |
CNY 3080.00 |
|
LY421362 | Transient overexpression lysate of family with sequence similarity 107, member A (FAM107A), transcript variant 2 |
CNY 3080.00 |
|
PH303787 | FAM107A MS Standard C13 and N15-labeled recombinant protein (NP_001070246) |
CNY 19520.00 |
|
PH319825 | FAM107A MS Standard C13 and N15-labeled recombinant protein (NP_009108) |
CNY 19520.00 |
|
TP319825 | Recombinant protein of human family with sequence similarity 107, member A (FAM107A), transcript variant 1, 20 µg |
CNY 2900.00 |
其它FAM107A产品