Achaete scute homolog 3 (ASCL3) (NM_020646) Human Mass Spec Standard
CAT#: PH320042
ASCL3 MS Standard C13 and N15-labeled recombinant protein (NP_065697)
View other "Achaete scute homolog 3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | ASCL3 MS Standard C13 and N15-labeled recombinant protein (NP_065697) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220042 |
Predicted MW | 20.7 kDa |
Protein Sequence |
>RC220042 representing NM_020646
Red=Cloning site Green=Tags(s) MMDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSE PCPFSFPMPYPNYRGCEYSYGPAFTRKRNERERQRVKCVNEGYAQLRHHLPEEYLEKRLSKVETLRAAIK YINYLQSLLYPDKAETKNNPGKVSSMIATTSHHADPMFRIV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_065697 |
RefSeq Size | 650 |
RefSeq ORF | 543 |
Synonyms | bHLHa42; HASH3; SGN1 |
Locus ID | 56676 |
Cytogenetics | 11p15.4 |
Summary | Basic helix-loop-helix transcription factors, such as ASCL3, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412408 | ASCL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412408 | Transient overexpression lysate of achaete-scute complex homolog 3 (Drosophila) (ASCL3) |
CNY 3080.00 |
|
TP320042 | Recombinant protein of human achaete-scute complex homolog 3 (Drosophila) (ASCL3), 20 µg |
CNY 2900.00 |
其它Achaete scute homolog 3产品