Achaete scute homolog 3 (ASCL3) (NM_020646) Human Recombinant Protein
CAT#: TP320042
Recombinant protein of human achaete-scute complex homolog 3 (Drosophila) (ASCL3), 20 µg
View other "Achaete scute homolog 3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220042 representing NM_020646
Red=Cloning site Green=Tags(s) MMDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSE PCPFSFPMPYPNYRGCEYSYGPAFTRKRNERERQRVKCVNEGYAQLRHHLPEEYLEKRLSKVETLRAAIK YINYLQSLLYPDKAETKNNPGKVSSMIATTSHHADPMFRIV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065697 |
Locus ID | 56676 |
UniProt ID | Q9NQ33 |
Refseq Size | 650 |
Cytogenetics | 11p15.4 |
Refseq ORF | 543 |
Synonyms | bHLHa42; HASH3; SGN1 |
Summary | Basic helix-loop-helix transcription factors, such as ASCL3, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412408 | ASCL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412408 | Transient overexpression lysate of achaete-scute complex homolog 3 (Drosophila) (ASCL3) |
CNY 3080.00 |
|
PH320042 | ASCL3 MS Standard C13 and N15-labeled recombinant protein (NP_065697) |
CNY 19520.00 |
其它Achaete scute homolog 3产品