C11orf20 (TEX40) (NM_001039496) Human Mass Spec Standard
CAT#: PH320639
C11orf20 MS Standard C13 and N15-labeled recombinant protein (NP_001034585)
View other "C11orf20" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | C11orf20 MS Standard C13 and N15-labeled recombinant protein (NP_001034585) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220639 |
Predicted MW | 22.7 kDa |
Protein Sequence |
>RC220639 representing NM_001039496
Red=Cloning site Green=Tags(s) MEEKPSKVSLKSSDRQGSDEESVHSDTRDLWTTTTLSQAQLNMPLSEVCEGFDEEGRNISKTRGWHSPGR GSLDEGYKASHKPEELDEHALVELELHRGSSMEINLGEKDTASQIEAEKSSSMSSLNIAKHMPHRAYWAE QQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001034585 |
RefSeq Size | 764 |
RefSeq ORF | 600 |
Synonyms | C11orf20; TEX40 |
Locus ID | 25858 |
Cytogenetics | 11q13.1 |
Summary | Auxiliary component of the CatSper complex, a complex involved in sperm cell hyperactivation. Sperm cell hyperactivation is needed for sperm motility which is essential late in the preparation of sperm for fertilization. Required for a distribution of the CatSper complex in linear quadrilateral nanodomains along the flagellum, maximizing fertilization inside the mammalian female reproductive tract. Together with EFCAB9, associates with the CatSper channel pore and is required for the two-row structure of each single CatSper channel.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422061 | TEX40 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422061 | Transient overexpression lysate of chromosome 11 open reading frame 20 (C11orf20) |
CNY 3080.00 |
|
TP320639 | Recombinant protein of human chromosome 11 open reading frame 20 (C11orf20), 20 µg |
CNY 2900.00 |
其它C11orf20产品