C11orf20 (TEX40) (NM_001039496) Human Recombinant Protein
CAT#: TP320639
Recombinant protein of human chromosome 11 open reading frame 20 (C11orf20), 20 µg
View other "C11orf20" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220639 representing NM_001039496
Red=Cloning site Green=Tags(s) MEEKPSKVSLKSSDRQGSDEESVHSDTRDLWTTTTLSQAQLNMPLSEVCEGFDEEGRNISKTRGWHSPGR GSLDEGYKASHKPEELDEHALVELELHRGSSMEINLGEKDTASQIEAEKSSSMSSLNIAKHMPHRAYWAE QQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001034585 |
Locus ID | 25858 |
UniProt ID | Q9NTU4 |
Refseq Size | 764 |
Cytogenetics | 11q13.1 |
Refseq ORF | 600 |
Synonyms | C11orf20; TEX40 |
Summary | Auxiliary component of the CatSper complex, a complex involved in sperm cell hyperactivation. Sperm cell hyperactivation is needed for sperm motility which is essential late in the preparation of sperm for fertilization. Required for a distribution of the CatSper complex in linear quadrilateral nanodomains along the flagellum, maximizing fertilization inside the mammalian female reproductive tract. Together with EFCAB9, associates with the CatSper channel pore and is required for the two-row structure of each single CatSper channel.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422061 | TEX40 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422061 | Transient overexpression lysate of chromosome 11 open reading frame 20 (C11orf20) |
CNY 3080.00 |
|
PH320639 | C11orf20 MS Standard C13 and N15-labeled recombinant protein (NP_001034585) |
CNY 19520.00 |
其它C11orf20产品