GLEPP1 (PTPRO) (NM_030671) Human Mass Spec Standard
CAT#: PH320785
PTPRO MS Standard C13 and N15-labeled recombinant protein (NP_109596)
View other "GLEPP1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PTPRO MS Standard C13 and N15-labeled recombinant protein (NP_109596) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220785 |
| Predicted MW | 47.2 kDa |
| Protein Sequence |
>Peptide sequence encoded by RC220785
Blue=ORF Red=Cloning site Green=Tag(s) MVTEMNPNVVVISVLAILSTLLIGLLLVTLIILRKKHLQMARECGAGTFVNFASLERDGKLPYNWRRSI FAFLTLLPSCLWTDYLLAFYINPWSKNGLKKRKLTNPVQLDDFDAYIKDMAKDSDYKFSLQFEELKLIG LDIPHFAADLPLNRCKNRYTNILPYDFSRVRLVSMNEEEGADYINANYIPGYNSPQEYIATQGPLPETR NDFWKMVLQQKSQIIVMLTQCNEKRRVKCDHYWPFTEEPIAYGDITVEMISEEEQDDWACRHFRINYAD EMQDVMHFNYTAWPDHGVPTANAAESILQFVHMVRQQATKSKGPMIIHCSAGVGRTGTFIALDRLLQHI RDHEFVDILGLVSEMRSYRMSMVQTEEQYIFIHQCVQLMWMKKKQQFCISDVIYENVSKS myc-FLAG tag Recombinant protein using RC220785 also available, TP320785 |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_109596 |
| RefSeq Size | 5002 |
| RefSeq ORF | 1215 |
| Synonyms | GLEPP1; NPHS6; PTP-OC; PTP-U2; PTPROT; PTPU2; R-PTP-O |
| Locus ID | 5800 |
| Cytogenetics | 12p13-p12 |
| Summary | This gene encodes a member of the R3 subtype family of receptor-type protein tyrosine phosphatases. These proteins are localized to the apical surface of polarized cells and may have tissue-specific functions through activation of Src family kinases. This gene contains two distinct promoters, and alternatively spliced transcript variants encoding multiple isoforms have been observed. The encoded proteins may have multiple isoform-specific and tissue-specific functions, including the regulation of osteoclast production and activity, inhibition of cell proliferation and facilitation of apoptosis. This gene is a candidate tumor suppressor, and decreased expression of this gene has been observed in several types of cancer. [provided by RefSeq, May 2011] |
| Protein Families | Phosphatase, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403070 | PTPRO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC410736 | PTPRO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410737 | PTPRO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410739 | PTPRO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403070 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, O (PTPRO), transcript variant 1 |
CNY 4840.00 |
|
| LY410736 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, O (PTPRO), transcript variant 4 |
CNY 3080.00 |
|
| LY410737 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, O (PTPRO), transcript variant 3 |
CNY 3080.00 |
|
| LY410739 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, O (PTPRO), transcript variant 5 |
CNY 3080.00 |
|
| PH314619 | PTPRO MS Standard C13 and N15-labeled recombinant protein (NP_109594) |
CNY 19520.00 |
|
| TP314619 | Recombinant protein of human protein tyrosine phosphatase, receptor type, O (PTPRO), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP320785 | Recombinant protein of human protein tyrosine phosphatase, receptor type, O (PTPRO), transcript variant 5, 20 µg |
CNY 2900.00 |
