GLEPP1 (PTPRO) (NM_030669) Human Recombinant Protein
CAT#: TP314619
Recombinant protein of human protein tyrosine phosphatase, receptor type, O (PTPRO), transcript variant 3, 20 µg
View other "GLEPP1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>Peptide sequence encoded by RC214619
Blue=ORF Red=Cloning site Green=Tag(s) MVTEMNPNVVVISVLAILSTLLIGLLLVTLIILRKKHLQMARECGAGTFVNFASLERDGKLPYNWRRSI FAFLTLLPSCLWTDYLLAFYINPWSKNGLKKRKLTNPVQLDDFDAYIKDMAKDSDYKFSLQFEELKLIG LDIPHFAADLPLNRCKNRYTNILPYDFSRVRLVSMNEEEGADYINANYIPGYNSPQEYIATQGPLPETR NDFWKMVLQQKSQIIVMLTQCNEKRRVKCDHYWPFTEEPIAYGDITVEMISEEEQDDWACRHFRINYAD EMQDVMHFNYTAWPDHGVPTANAAESILQFVHMVRQQATKSKGPMIIHCSAGVGRTGTFIALDRLLQHI RDHEFVDILGLVSEMRSYRMSMVQTEEQYIFIHQCVQLMWMKKKQQFCISDVIYENVSKS myc-FLAG tag Recombinant protein using RC214619 also available, TP314619 |
| Tag | C-Myc/DDK |
| Predicted MW | 47 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_109594 |
| Locus ID | 5800 |
| UniProt ID | Q16827 |
| Refseq Size | 3970 |
| Cytogenetics | 12p13-p12 |
| Refseq ORF | 1215 |
| Synonyms | GLEPP1; NPHS6; PTP-OC; PTP-U2; PTPROT; PTPU2; R-PTP-O |
| Summary | This gene encodes a member of the R3 subtype family of receptor-type protein tyrosine phosphatases. These proteins are localized to the apical surface of polarized cells and may have tissue-specific functions through activation of Src family kinases. This gene contains two distinct promoters, and alternatively spliced transcript variants encoding multiple isoforms have been observed. The encoded proteins may have multiple isoform-specific and tissue-specific functions, including the regulation of osteoclast production and activity, inhibition of cell proliferation and facilitation of apoptosis. This gene is a candidate tumor suppressor, and decreased expression of this gene has been observed in several types of cancer. [provided by RefSeq, May 2011] |
| Protein Families | Phosphatase, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403070 | PTPRO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC410736 | PTPRO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410737 | PTPRO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410739 | PTPRO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403070 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, O (PTPRO), transcript variant 1 |
CNY 4840.00 |
|
| LY410736 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, O (PTPRO), transcript variant 4 |
CNY 3080.00 |
|
| LY410737 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, O (PTPRO), transcript variant 3 |
CNY 3080.00 |
|
| LY410739 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, O (PTPRO), transcript variant 5 |
CNY 3080.00 |
|
| PH314619 | PTPRO MS Standard C13 and N15-labeled recombinant protein (NP_109594) |
CNY 19520.00 |
|
| PH320785 | PTPRO MS Standard C13 and N15-labeled recombinant protein (NP_109596) |
CNY 19520.00 |
|
| TP320785 | Recombinant protein of human protein tyrosine phosphatase, receptor type, O (PTPRO), transcript variant 5, 20 µg |
CNY 2900.00 |
