NOVA1 (NM_006489) Human Mass Spec Standard
CAT#: PH321328
NOVA1 MS Standard C13 and N15-labeled recombinant protein (NP_006480)
View other "NOVA1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NOVA1 MS Standard C13 and N15-labeled recombinant protein (NP_006480) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221328 |
| Predicted MW | 49.1 kDa |
| Protein Sequence |
>RC221328 representing NM_006489
Red=Cloning site Green=Tags(s) MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNTGEDGQYFLKVLIPSYAAGSIIGKGGQ TIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQT TVNPDRIKQVKIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAV ELIIQKIQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAEVLPTAAAAAGLLGHANLAGVAAFPAVL SGFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATGALAAAAASANPAAAAANLLATYASEASASGS TAGGTAGTFALGSLAAATAATNGYFGAASPLAASAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTL VEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006480 |
| RefSeq Size | 3846 |
| RefSeq ORF | 1449 |
| Synonyms | Nova-1 |
| Locus ID | 4857 |
| Cytogenetics | 14q12 |
| Summary | This gene encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. Alternatively spliced transcripts encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400898 | NOVA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416609 | NOVA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY400898 | Transient overexpression lysate of neuro-oncological ventral antigen 1 (NOVA1), transcript variant 1 |
CNY 3080.00 |
|
| LY416609 | Transient overexpression lysate of neuro-oncological ventral antigen 1 (NOVA1), transcript variant 2 |
CNY 4840.00 |
|
| PH310407 | NOVA1 MS Standard C13 and N15-labeled recombinant protein (NP_002506) |
CNY 19520.00 |
|
| TP310407 | Recombinant protein of human neuro-oncological ventral antigen 1 (NOVA1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP321328 | Recombinant protein of human neuro-oncological ventral antigen 1 (NOVA1), transcript variant 2, 20 µg |
CNY 2900.00 |
