NOVA1 (NM_006489) Human Recombinant Protein
CAT#: TP321328
Recombinant protein of human neuro-oncological ventral antigen 1 (NOVA1), transcript variant 2, 20 µg
View other "NOVA1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221328 representing NM_006489
Red=Cloning site Green=Tags(s) MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNTGEDGQYFLKVLIPSYAAGSIIGKGGQ TIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQT TVNPDRIKQVKIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAV ELIIQKIQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAEVLPTAAAAAGLLGHANLAGVAAFPAVL SGFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATGALAAAAASANPAAAAANLLATYASEASASGS TAGGTAGTFALGSLAAATAATNGYFGAASPLAASAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTL VEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 49.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006480 |
| Locus ID | 4857 |
| UniProt ID | P51513 |
| Refseq Size | 3846 |
| Cytogenetics | 14q12 |
| Refseq ORF | 1449 |
| Synonyms | Nova-1 |
| Summary | This gene encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. Alternatively spliced transcripts encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400898 | NOVA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416609 | NOVA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY400898 | Transient overexpression lysate of neuro-oncological ventral antigen 1 (NOVA1), transcript variant 1 |
CNY 3080.00 |
|
| LY416609 | Transient overexpression lysate of neuro-oncological ventral antigen 1 (NOVA1), transcript variant 2 |
CNY 4840.00 |
|
| PH310407 | NOVA1 MS Standard C13 and N15-labeled recombinant protein (NP_002506) |
CNY 19520.00 |
|
| PH321328 | NOVA1 MS Standard C13 and N15-labeled recombinant protein (NP_006480) |
CNY 19520.00 |
|
| TP310407 | Recombinant protein of human neuro-oncological ventral antigen 1 (NOVA1), transcript variant 1, 20 µg |
CNY 2900.00 |
