PAOX (NM_207127) Human Mass Spec Standard
CAT#: PH321583
PAOX MS Standard C13 and N15-labeled recombinant protein (NP_997010)
View other "PAOX" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | PAOX MS Standard C13 and N15-labeled recombinant protein (NP_997010) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221583 |
Predicted MW | 34.5 kDa |
Protein Sequence |
>RC221583 representing NM_207127
Red=Cloning site Green=Tags(s) MESTGSVGEAPGGPRVLVVGGGIAGLGAAQRLCGHSAFPHLRVLEATARAGGRIRSERCFGGVVEVGAHW IHGPSRGNPVFQLAAEYGLLGEKELSQENQLVETGGHVGLPSVSYASSGASVSLQLVAEMATLFYGLIDQ TREFLHAAETPVPSVGEYLKKEIGQHVAGWTEDEETRKLKLAVLNSFFNLECCVSGTHSMDLVALAPFGE YTVLPGLDCTFSKGYQGLTNCMMAALPEDTVVFEKPVKTIHWNGSFQEAAFPGETFPVSVECEDGDRFPA HHVIVTVPLGLSTFSVGSLPDLSLSSWRLCRMKKYFCVSPKCSGE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_997010 |
RefSeq Size | 1467 |
RefSeq ORF | 975 |
Synonyms | PAO |
Locus ID | 196743 |
Cytogenetics | 10q26.3 |
Summary | Flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion (PubMed:12477380). Can also oxidize N(1)-acetylspermidine to putrescine. Substrate specificity: N(1)-acetylspermine = N(1)-acetylspermidine > N(1),N(12)-diacylspermine >> spermine. Does not oxidize spermidine. Plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs (PubMed:12477380).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404057 | PAOX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404058 | PAOX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC407209 | PAOX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404057 | Transient overexpression lysate of polyamine oxidase (exo-N4-amino) (PAOX), transcript variant 4 |
CNY 3080.00 |
|
LY404058 | Transient overexpression lysate of polyamine oxidase (exo-N4-amino) (PAOX), transcript variant 5 |
CNY 4840.00 |
|
LY407209 | Transient overexpression lysate of polyamine oxidase (exo-N4-amino) (PAOX), transcript variant 1 |
CNY 3080.00 |
|
PH324235 | PAOX MS Standard C13 and N15-labeled recombinant protein (NP_997011) |
CNY 19520.00 |
|
TP321583 | Purified recombinant protein of Homo sapiens polyamine oxidase (exo-N4-amino) (PAOX), transcript variant 4, 20 µg |
CNY 2900.00 |
|
TP324235 | Recombinant protein of human polyamine oxidase (exo-N4-amino) (PAOX), transcript variant 5, 20 µg |
CNY 2900.00 |