PAOX (NM_207128) Human Recombinant Protein
CAT＃: TP324235
Recombinant protein of human polyamine oxidase (exo-N4-amino) (PAOX), transcript variant 5, 20 µg
View other "PAOX" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC224235 representing NM_207128
Red=Cloning site Green=Tags(s) MESTGSVGEAPGGPRVLVVGGGIAGLGAAQRLCGHSAFPHLRVLEATARAGGRIRSERCFGGVVEVGAHW IHGPSRGNPVFQLAAEYGLLGEKELSQENQLVETGGHVGLPSVSYASSGASVSLQLVAEMATLFYGLIDQ TREFLHAAETPVPSVGEYLKKEIGQHVAGWTEDEETRKLKLAVLNSFFNLECCVSGTHSMDLVALAPFGE YTVLPGLDCTFSKGYQGLTNCMMAALPEDTVVFEKPVKTIHWNGSFQEAAFPGETFPVSVECEDGDRFPA HHVIVTVPLGFLREHLDTFFDPPLPAEKAEAIRKIGFGTNNKIFLEFEEPFWEPDCQLIQLVWEDTSPLE DAAPELQDAWFRKLIGFVVLPAFASVHVLCGFIAGLESEFMETLSDEEVLLCLTQVLRRVTAPDPVCGGS HTSHVLLHDARGSAVGMEGGRPPPQSVGPAGAAAQAQALAGPSLLCSTRVGGRLGPSFLLTDFSLA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 51.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_997011 |
| Locus ID | 196743 |
| UniProt ID | Q6QHF9 |
| Refseq Size | 1720 |
| Cytogenetics | 10q26.3 |
| Refseq ORF | 1458 |
| Synonyms | PAO |
| Summary | Flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion (PubMed:12477380). Can also oxidize N(1)-acetylspermidine to putrescine. Substrate specificity: N(1)-acetylspermine = N(1)-acetylspermidine > N(1),N(12)-diacylspermine >> spermine. Does not oxidize spermidine. Plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs (PubMed:12477380).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404057 | PAOX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404058 | PAOX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC407209 | PAOX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404057 | Transient overexpression lysate of polyamine oxidase (exo-N4-amino) (PAOX), transcript variant 4 |
CNY 3080.00 |
|
| LY404058 | Transient overexpression lysate of polyamine oxidase (exo-N4-amino) (PAOX), transcript variant 5 |
CNY 4840.00 |
|
| LY407209 | Transient overexpression lysate of polyamine oxidase (exo-N4-amino) (PAOX), transcript variant 1 |
CNY 3080.00 |
|
| PH321583 | PAOX MS Standard C13 and N15-labeled recombinant protein (NP_997010) |
CNY 14250.00 |
|
| PH324235 | PAOX MS Standard C13 and N15-labeled recombinant protein (NP_997011) |
CNY 19520.00 |
|
| TP321583 | Purified recombinant protein of Homo sapiens polyamine oxidase (exo-N4-amino) (PAOX), transcript variant 4, 20 µg |
CNY 2900.00 |
